DPCstruct | MC12532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7GCE3 | 324-436 | LRVWTESIMSLLEHVPCRSDFFRYIHWHNLAFFTTDDLELDTIVFYYEDYGNDFNRTVNRVLEFLALPQIGSAAPFTTGKNYSDFYT… |
| A0A6U0JC01 | 1-115 | SKSRFINEEVLELFKKIPCHGDFFRYIQWHNFAVATTAKLDLPTYILHYENYASDFDLTKTQLMDFLELDIVGEVPEFIPGKSYRNY… |
| A0A7S0C4C6 | 161-275 | None |
| A0A7S2E4P3 | 208-330 | None |
| B7GCE2 | 470-582 | None |
| B7FUK0 | 280-394 | None |
| A0A7S0C5J7 | 124-233 | None |
| A0A7S1VGR6 | 1-113 | None |
| A0A7S1V3L1 | 122-236 | None |
| A0A7S4VBQ4 | 197-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.