DPCstruct | MC12530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 215 ± 27 aa |
| Standard deviation of domain lengths | 27.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3IVY2 | 20-182 | LKYLEFVQVATVHAVLCFTNLYLKAKEKSGPLKTGVETVEGTVKTVVGPVYEKYHDVPAELLKFVDRKYEPAAKGLYAKYEPKAEQC… |
| A0A836XYJ0 | 10-233 | QLAREEEERRLKYLQFVQVAAVHAVLTFTNLYIYAKDKAGPLKPGVETVEGTVKSVVGLVYDKFRDVPIEVLKFVDRKVDESVTSLD… |
| M9PNM8 | 1-208 | None |
| M9PNQ7 | 3-217 | None |
| A0A2G3B8W9 | 5-201 | None |
| B6TIK3 | 8-254 | None |
| A0A0P0XAA0 | 42-298 | None |
| A0A4S8J6K3 | 108-328 | None |
| O82803 | 3-202 | None |
| A0A5J5BTR2 | 15-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.