DPCstruct | MC1253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 132 ± 15 aa |
| Standard deviation of domain lengths | 14.80 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251SXA8 | 100-235 | CRVLRLGLEKIPDSVRLWKALVELANEDDAKRLLQRAVECCPLHFELWLALARLEKYDAAKKVLNKAREKLPKERAIWIAEAKLEEA… |
| A0A0B1PHS6 | 686-821 | KRVLRKALEYIPNSVRLWKAAVALEEPDDARILLSRAVECCPTSVDLWLALAKLETYENARKVLNKARENIPTDRHVWLTAAKLEEA… |
| A0A811LKW8 | 391-527 | None |
| A0A448WK26 | 1-105 | None |
| A0A4Y7NMI9 | 620-755 | None |
| J4H3N7 | 344-492 | None |
| A0A1E4SZM3 | 363-519 | None |
| A0A2H2IIG1 | 407-539 | None |
| A0A2H5NY98 | 2-117 | None |
| A0A5J4N317 | 2-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.