DPCstruct | MC12529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 11.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06101 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816V8V5 | 665-763 | NIKAGEKILKALPVETTFKFPSPLPTFTQGGGFAKGTIDLGGLEVSQVPTFNKVWSTYEGGPDNLGVTFFEPSSVPTGFSILGYYAQ… |
| A0A836XRA4 | 1-107 | MGNSTSATKEALPIDTSFKLPSPLPSLPQGEGFGNGVINLGVDCRCVRLFLLARSGLQMKGGRVPWSHLLRASQMPQGFSMLGCYSQ… |
| A0A816K863 | 331-436 | None |
| A0A218XUQ4 | 236-318 | None |
| A0A6A4MYW9 | 1-85 | None |
| A0A7C9AY68 | 1-95 | None |
| A0A835RJV8 | 1-131 | None |
| A0A6P8CFW6 | 174-285 | None |
| A0A6D2JRL4 | 35-139 | None |
| A0A0D3GSQ3 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.