DPCstruct | MC12528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 189 ± 40 aa |
| Standard deviation of domain lengths | 39.88 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2X8T2 | 36-206 | YVKARPGVDIDLDDHKCFSLRYVAHVDDGAGAGPLSYPNKDKLLHANIPVKILVPHITLKAVRDIAKIHGIALDRKAQDKRERICEL… |
| A0A836XLI0 | 119-278 | VNKVGLIFHGVYSDIEVLQYPASVYLHVKADVTIILPLLSARECISVALKHGIVCGSKCTKSLIISMSQDHSCAICYSLTYVFEVKN… |
| A0A409X9T4 | 10-255 | None |
| A0A836DAV5 | 66-231 | None |
| A0A284RDJ5 | 9-179 | None |
| A0A284RAN5 | 60-215 | None |
| A0A0C3JB76 | 1-237 | None |
| A0A067TAZ2 | 540-690 | None |
| A0A067T1D6 | 10-169 | None |
| A8P9I4 | 112-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.