DPCstruct | MC12525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 162 ± 19 aa |
| Standard deviation of domain lengths | 19.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A319DTH0 | 178-321 | SSILDTACSSPVSSCSSALTNLATTLLHPSNCGHDYSAGNQLVVDLYTDLITYEPLYRATCLQSPVTNNYCFVDAVTNTSNAVNYDV… |
| A0A3M7E5Y2 | 16-175 | MSSLARTIKQPSNCGDDYKLENPMVRQAYAGFLAYETLYRVGCLTDSDGAYCFSNAVSNMTAPTSSYIYYLPLGVQLPAGTRPSCND… |
| A0A1C7LS10 | 355-505 | None |
| A0A1Y1YFV2 | 68-256 | None |
| A0A317XB36 | 7-143 | None |
| M5G9B2 | 148-298 | None |
| A0A395IIN8 | 191-345 | None |
| A0A0F7SNT3 | 200-335 | None |
| A0A218YUA9 | 465-622 | None |
| A0A0C2X7C0 | 5-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.