DPCstruct | MC12523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 184 ± 10 aa |
| Standard deviation of domain lengths | 10.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8UDF8 | 161-341 | AWVPTLGNLLTLAALGLGLALNCFLNGGLGAPEAIFMLAPILLLLSQDVLILPGLSERQRYCPPQLAISAYLLLTGVVQAVTDVLVG… |
| A0A7S1GFC2 | 19-223 | GGYVPSAVNEATVGSLAGKHHQKLTNIGMSYLPEACNILTVFCFSACLWVSNALGGEHASLMVPILCSILLLLSQDSFLLRGLADKR… |
| A4S6I8 | 811-987 | None |
| A0A7S1DDV8 | 2-183 | None |
| A0A7S4L973 | 101-291 | None |
| A0A7S3FLK5 | 312-485 | None |
| A0A6J0PMZ0 | 515-717 | None |
| A0A7C9EA37 | 379-559 | None |
| A0A8B6DJU1 | 372-539 | None |
| A0A5J5AEA4 | 8-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.