DPCstruct | MC12521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 154 ± 19 aa |
| Standard deviation of domain lengths | 18.51 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5TMW5 | 119-283 | ANYTYFTAPVDVTLPLLSCREGRLASDGTTRFRIAQTRQIIHVDDFCNQCGNCTTFCVHQGKPYLDKPRLFLREEDFVQEEDNAFYI… |
| A0A2H6HAJ5 | 9-160 | EPITMDLPVVTINDGASQVTDHTPFRVEQGYQIVVLTDFCNECGNCVTFCPTAGEPYRDKPRLYLNREDFLAETDNAFMLSESDGVP… |
| A0A7Y2C7N2 | 26-188 | None |
| A0A7C4JI25 | 53-212 | None |
| A0A849H1K3 | 355-529 | None |
| A0A7V4BLE8 | 166-325 | None |
| A0A496ZR97 | 958-1126 | None |
| A0A1G0TKX9 | 3-151 | None |
| A0A7C5QCW0 | 205-364 | None |
| A0A2N5ZA84 | 7-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.