DPCstruct | MC12516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 182 ± 20 aa |
| Standard deviation of domain lengths | 19.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.20 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0226- PF12414- PF12999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016SFL7 | 1-183 | MYALFQIFLSVDEIDADHFLNNTYERLKTEKVAYEDFKNDQAREQAEKDAQEKHEEDHDDLVADDDKADTEVYPDYTTTPSPPSEDE… |
| A0A6V7V8S0 | 2-135 | IKNKFKNIKDFLIKCKEKKQKEGNEEEGIKEEGEKDEEEDKEEPKYDEETQKLIENANIARKEFGEIESQIGQLQDDIKNSEQFLNQ… |
| A0A834DUC4 | 1-184 | None |
| A0A7E4RJ75 | 209-422 | None |
| A0A438JVV8 | 194-367 | None |
| A0A7N6AAH0 | 153-346 | None |
| J9F555 | 24-199 | None |
| A0A812B3B8 | 198-389 | None |
| A0A7S2RLX4 | 91-259 | None |
| A0A6I9Q3R2 | 177-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.