DPCstruct | MC12512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 413 ± 87 aa |
| Standard deviation of domain lengths | 87.19 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.32 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF07093- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015LQ57 | 12-304 | VDAVVYSIYFPLPTSDQISFLQEISTLILSDLNQYLNEYIWQKDPFELRIAKNESDPSYPFLHGKTRFGDCIDDEWFIVFLLRQISL… |
| H3FEK3 | 38-456 | DEIYVAIVEEIKDFVYDTTKILLQPKGYSGVPLYGKTPLNTRPDDLWKTIEILFKLSNKFAGLLFSISTDDPHHNPLFVEADKNDVL… |
| A0A3Q0J1L6 | 11-311 | None |
| A0A1R0H6R7 | 2-321 | None |
| G8BED9 | 26-544 | None |
| A0A194V2Y9 | 34-598 | None |
| A0A1E4SJY2 | 23-440 | None |
| A0A1E7FT62 | 38-574 | None |
| A0A811PI31 | 534-948 | None |
| A0A183KT85 | 1-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.