DPCstruct | MC1251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 20.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540LZM9 | 205-361 | MSSGTLACAAKEGVKLYVNNIRAAHVEKIRHKAIESELSDALSQGISAKDATKQAQEVGAKAAKLATRQAKRIIGPIISSGWDFFEA… |
| A0A7J7NUX9 | 3-190 | GEEASSKSGQFTLLNCFDMSSGSIACAVKEGVKLYFYNIRSSHVERVRHKAITTSLTDALSQGLGAEAAAKKAQTDGAKAAKLASRQ… |
| A0A3L6DHX9 | 36-187 | None |
| A0A6A3CI54 | 29-194 | None |
| A0A438G7P8 | 21-173 | None |
| A0A6J1KHG8 | 57-189 | None |
| A0A6P3Z7M3 | 50-170 | None |
| A9NMY3 | 50-205 | None |
| A0A1U8FLL7 | 1-161 | None |
| A0A1J7GYU1 | 471-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.