DPCstruct | MC12501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9Z5S3 | 46-106 | TPSPSPSPIASPSPSLTPRGRGLGTDGECICPNCGYTMPHERGVPCTELTCPECGARMIRK |
| A0A842TS23 | 99-162 | RAGAGKGRGLRRRAPAGGRGRMGGSSAGPGGKCKCPKCGHEEPQTRGQPCMNKKCPKCGKLMTR |
| A0A7X8X5F0 | 10-78 | None |
| A0A0S7WY95 | 7-74 | None |
| A0A3B9T9F9 | 1-61 | None |
| A0A7K4HPY3 | 1-55 | None |
| A0A424XY47 | 183-245 | None |
| A0A496PPP9 | 34-99 | None |
| A0A3A4VI01 | 4-64 | None |
| U5CJL1 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.