DPCstruct | MC1250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Standard deviation of domain lengths | 16.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 93.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 66.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YGW1 | 4-96 | YFWLDFQQLNDIYRYKTEEYSHTAVNKFNVIPDSIPDWVFDFMPCRGGYFIGNVSPARMDFRWFALGNCVAILSSLATPEQSVAIMD… |
| A0A426Y8S5 | 5-121 | DVEGKEFMERILTRLNALGYHMRSYFWLDFQQLNDIYRYKTEEYSHTAVNKFNVIPDSIPDWIFDFMPTRGGYFVGNVSPAKMDFRW… |
| A0A287TE98 | 1-127 | None |
| A0A7C8YTL9 | 1-90 | None |
| A0A6A2YKR4 | 111-238 | None |
| A0A5D2RUP3 | 351-465 | None |
| A0A6A6KM55 | 184-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.