DPCstruct | MC125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 157 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7A0J0 | 14-153 | WPSPDDFWDFTCRTYSHASMQEACLDAQDSLGADVNLLLLCLWMDDNSVRPVADDWDLLMEAASWWQEEKLAPLRMARRALKGQDGY… |
| A0A6A7SB96 | 15-180 | LWDFAVRVYGMQGIKDTCLAVQARYGLSISTLLGAIWTGAHGYGRMGATQLETTVRRATEWHREVIEPMRALRRRLRQQPPPGLETR… |
| A0A3S0UI71 | 67-243 | None |
| A0A432WJM3 | 14-135 | None |
| A0A1E5CG34 | 2-119 | None |
| A0A5C7YEC0 | 43-216 | None |
| A0A558HSD1 | 49-254 | None |
| A0A3N5ZAT9 | 4-140 | None |
| A0A1E7PX14 | 16-161 | None |
| A0A7U3HB76 | 8-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.