DPCstruct | MC12499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 46.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0WER9 | 10-74 | GKITTIKLLEETKLRLEKLREHKRESYDDILRKILYVLNVAREEPERAKRILEKISDIRTRMLEE |
| A0A7J3RAZ8 | 1-78 | MNNVTTIKIKKETKERLLKIKEHEKESFDEILNKILYVLNVCKKDSEKAKKILIGIDKRIKRREILKKKILFNKNNNF |
| A0A2G9NQS2 | 2-74 | None |
| A0A2G9NDY6 | 1-70 | None |
| A0A3M0Y7D6 | 12-84 | None |
| A0A2D6NBP6 | 5-73 | None |
| A0A2D6KEQ2 | 18-79 | None |
| A0A1G2I985 | 17-78 | None |
| A0A7C5BF96 | 2-74 | None |
| A0A2H9QJC0 | 10-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.