DPCstruct | MC12497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 354 ± 19 aa |
| Standard deviation of domain lengths | 19.40 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.17 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0220- CL0125- PF16648- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7SXH5 | 380-748 | VYEDDGEFWMSFQDFVSNFQKLEICNLAPDSLDEDELNARSKKRWESTCESGSWVKRVSAGGCRNYLDTFWTNPQFKVSLTDPDDDD… |
| A0A210QM44 | 704-1062 | IVVRNDGEFWMSYHDLLLNFDEVQLCHLQPDALTSEIVNDEKQEAWQVVVYHDAWLKGVTAGGCGNKPHQDLYWRNPQFFITLKDVD… |
| A0A836CV14 | 327-688 | None |
| A0A7R9JXE5 | 398-722 | None |
| A0A662YND4 | 282-601 | None |
| A0A210QPN2 | 589-968 | None |
| A0A4Z2HVP4 | 726-1090 | None |
| A0A4Z2AYD2 | 109-478 | None |
| A0A7I8VY88 | 732-1086 | None |
| A0A6F8ZK98 | 77-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.