DPCstruct | MC12493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 18.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 67.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.93 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0BJQ9 | 18-138 | EKKKSKKLKKTHKSKKRSENLKNINETSKAKQRESDTDDNFEIPVTLMNSKSHAPETPEEYQRRQNKIRRETDPVTGRSRLIRGSGE… |
| A0A6A4SS62 | 1-131 | MGRSRSPDRADRDKKKKKRRRSSSSSTSSSSPSSSSSNSRARSRSSKKGAHKDQVMTDEQKARLSTKRPLTKEEYEARQSVIRRVVD… |
| F6YRL7 | 70-197 | None |
| A0A093Q2R0 | 114-253 | None |
| A0A2K6PMI5 | 176-288 | None |
| T1FTS1 | 1-150 | None |
| A0A6P6C949 | 187-292 | None |
| A0A6P7FAC8 | 131-243 | None |
| A0A6J1Y3V1 | 90-238 | None |
| K0T4Z7 | 76-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.