DPCstruct | MC12491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 154 ± 21 aa |
| Standard deviation of domain lengths | 20.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11568 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7Z9P5 | 2-133 | LIPQLRESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDA… |
| A0A6A4SJC5 | 2-162 | SQPGLQQSASIQQQQQQLSQQQDFDPVHRFKMLIPQLKESLQNLMKIASLNLAHNTSIDNGIKSSDASVQRFDKSLEEFYALCDQLE… |
| A0A2Y9P2V3 | 28-152 | None |
| A0A2M3ZD45 | 35-183 | None |
| A0A3Q4BBP0 | 1-152 | None |
| A0A7R9QNL9 | 12-195 | None |
| A0A6P8IG38 | 3-143 | None |
| T1PBI7 | 830-1001 | None |
| A0A7J8CJ92 | 27-196 | None |
| T1KT70 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.