DPCstruct | MC12490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 76 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4SEJ8 | 11-71 | VARRAFSSSAGQLRNRIREAQKLFQEDNGLPVHLKGGSRDVLLYRATMTLTLAASMPQKKA |
| A0A3B4BY52 | 1-60 | MRNKVPEKQKIFQEDNGLPVHIKGGTTDVLLYRLTMSLTIAGTGFSCYWLLVASMPRSKA |
| A0A287CYE4 | 6-71 | None |
| A0A2D0PXK3 | 37-119 | None |
| H3AAH4 | 25-102 | None |
| A0A3B3Q7F4 | 1-66 | None |
| I3MIU4 | 29-115 | None |
| A0A3Q2XXS1 | 61-141 | None |
| G5AMW5 | 147-269 | None |
| A0A673YB69 | 4-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.