DPCstruct | MC1249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 138 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03839 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4RYX4 | 1-153 | MSARKERAAQEIDHLAYVLRGRDGPETRSARLGDNRFDFFRGKDFYRVLRERVDVLDEYCAVDERQRREMEADAAKRDEVNAMRIKH… |
| A0A7J7NS48 | 1-136 | MRVRCVQNSSTDLNNDTPPWKKPGKYLFQLFADKIRDHKDLKSRWAVLQETRVEYFRGKGFVSLLKNHPELKDIFESDKSLGAEDIA… |
| A0A812J913 | 3-140 | None |
| A0A2T3BB79 | 73-216 | None |
| A0A6V7PNX5 | 9-145 | None |
| A0A4Y8DEI0 | 174-303 | None |
| A0A0G2E2C0 | 47-187 | None |
| A0A0C2JMJ8 | 1-126 | None |
| A0A4T0G0R8 | 2-116 | None |
| L7IJY5 | 70-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.