DPCstruct | MC12489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 5.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 67.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4SDE0 | 15-76 | FLKSENRSEKELSEIHCSALAYMLQMSEEVLDELDLNKYNTSQEGRWRLIPAVRNCRKARFI |
| A0A096LY83 | 193-252 | QEIQQLLKSGKELSEIQCSALAFMLQMSEVLDELDLEKYNTSEWGRLRLVPAVRNCRKAR |
| A0A5C6MHH6 | 106-166 | None |
| A0A0F8B1A3 | 88-148 | None |
| A0A5C6MJZ0 | 82-170 | None |
| A0A2R8QQ45 | 726-786 | None |
| A0A1S3QC89 | 414-474 | None |
| A0A667Z1X8 | 60-121 | None |
| A0A6J2WAM2 | 372-431 | None |
| A0A4U5TVE6 | 1030-1090 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.