DPCstruct | MC12488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 141 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.86 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | PF08337- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3A2E1 | 298-414 | FWINILKNPQFIFDIEKTPHLDSCLSVIAQAFMDAFSLTDHQLGKHAPTNKLLYAKDIPQFKEEVKAYYKQIQELPSLSSQEVEEFL… |
| A0A6A4SBK2 | 2-145 | RFWVNILRNPHFIFDVHVTEVVDASLHVISQTFMDACTKTEHKLSRESPSNKLLYAKEISTYKKNVDDYYRGIRQMVPVSDQDMNTH… |
| A0A2H2I224 | 75-223 | None |
| A0A3B3QIQ7 | 242-389 | None |
| A0A5J5CEK7 | 579-732 | None |
| A0A0K0E5W4 | 2-145 | None |
| A0A2B4SHF4 | 653-799 | None |
| A0A7R8X038 | 833-978 | None |
| T1H2W6 | 1-115 | None |
| T1FRH1 | 537-686 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.