DPCstruct | MC12487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 10.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7IDF8 | 1-84 | MKIDIKKFGIILVSRPAGKEAWLAFQPTLNEINSNEKIIVDFEGVVVLTPSWADEFLTPLKQKFREVDLINTNNPSVKATLAIL |
| A0A7V5P2N4 | 1-95 | MRINLKDFGGFLSSPELGKRIGISVLDSLRKEPENNVILDFSGVQGVNRHFCEEFISVVFRGVGFEDFKKRIVIHNQTQIVRMVFDS… |
| A0A2W4RIJ9 | 12-105 | None |
| A0A847SX72 | 6-95 | None |
| A0A1F6ZMM1 | 3-95 | None |
| A0A354SAC7 | 75-165 | None |
| A0A3C1RXY8 | 50-158 | None |
| L0D9F9 | 93-182 | None |
| A0A7W3PLH4 | 209-314 | None |
| A0A6P0V0E3 | 128-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.