DPCstruct | MC12484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 287 ± 27 aa |
| Standard deviation of domain lengths | 27.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4KM27 | 38-330 | TINGLEFPERSLLLFITACVTFLTLIIGMILLPILSEGEVVPPTDPKLMLILREVISELYEDLDNKKLSEKERFALLAVIANYQGRI… |
| A0A0B8RCZ8 | 1-278 | MIATFILPLLAKSEEVTTEDERAETATRIRILRNVIRELKEQTLPETKAATDEVIEDYRRRIYDLQQNNSSNRGMDERERAKRLEII… |
| A0A3A9AMB6 | 2-287 | None |
| A0A1V4G702 | 2-228 | None |
| A0A0R2K331 | 1-324 | None |
| A0A380FDH3 | 1-266 | None |
| A0A1W1UJ83 | 46-343 | None |
| A0A5C8X334 | 83-385 | None |
| A0A4S3B369 | 189-462 | None |
| A0A7X5DBY1 | 121-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.