DPCstruct | MC12483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 189 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561UBH0 | 59-251 | GAEEARAASTALAEVRGGDLNALREAADRLSAEAALREPTTVAEVVTLVGLLRRIRETAGTLRSGAYEADLDALAAATANGSWRKER… |
| A0A0S9KDH4 | 1-194 | MNTRLSARTLTVAADPAVIASRLTMLVENAAELIGEAGLHPFTMFADMRDRLWLLRDIERTLWQFRPIATAVDLRTMIAAAAPTRAA… |
| A0A420X8R6 | 1-183 | None |
| A0A0K2RPZ5 | 191-384 | None |
| A0A0D8HJM6 | 138-328 | None |
| A0A1Q9T7L6 | 2-161 | None |
| A0A7W7S8L0 | 57-243 | None |
| A0A4P6FGJ9 | 204-397 | None |
| A0A1H1ZUV8 | 77-285 | None |
| A0A251XK27 | 452-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.