DPCstruct | MC12482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 192 ± 26 aa |
| Standard deviation of domain lengths | 26.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151F737 | 8-266 | VVVIVLVGLSLFSFSTKYEPKYEYGFSGSQIYKAVRECEELDSSGFLYTVYVRGYWNADVGHFEEEAFVIDTGRGYMELVLKDGRTV… |
| A0A402DL83 | 36-222 | NSGGGLIRGFNQALGLPSGAIETVNEDASRYLLRVRVQGRNAITEQPIDATYEVIEPLTVSDLLVKDEGGTVYRLGSSQESQIIASR… |
| A0A533YKK9 | 180-362 | None |
| A0A662NWW8 | 26-231 | None |
| A0A520KN10 | 2-237 | None |
| A0A7V0JUQ7 | 180-350 | None |
| A0A075LPU5 | 10-219 | None |
| A0A831SL96 | 164-354 | None |
| A0A7W0RGZ8 | 168-356 | None |
| A0A6I7PTZ3 | 2-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.