DPCstruct | MC1248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 62.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0403- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1N8Q8 | 12-84 | RAPWRFQGRALYQLCLIKSSDARKHVPDDLKLVEAFGYTLGGVYLARYDDSPAGTFDELVALGGLVWNPPTSC |
| A0A7J7NQZ0 | 1-98 | MEVAETKSSSSYAKPPWLFKGRHFLYDLHCVISALYQLHLVKAETARAFIPKEFKLVEAFGYTLGGFFLAHYDDSPAGMFDELVVIA… |
| A0A822YE56 | 1-74 | None |
| A0A6J4HLQ3 | 1-88 | None |
| A0A6G1F2C4 | 7-97 | None |
| A0A830C7Q0 | 28-116 | None |
| A0A4U5QHQ7 | 409-494 | None |
| A0A103SR45 | 1-86 | None |
| A0A6I9RCA3 | 1-89 | None |
| A0A1D6KRL0 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.