DPCstruct | MC12479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 6.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6T6S6 | 100-196 | KEASFPACDGRNILILMSVIDEHGAEATYNELAQAVLTGGPADKKFTVPGKCASLRKTVNGNVIYPVYLDFGSDEAGMCAAKARYGG… |
| A0A1L7CZ72 | 145-242 | PEGAREAPTDPPCDGRGILIHESVWGPEAGRKVNAALAAHPGSVYASAGACPSLNPEREGYPVYAVYEDFGHDLEALCAADRGAGTM… |
| A0A2S9YZ73 | 138-235 | None |
| A0A3R8VVW6 | 200-298 | None |
| A0A3R8VU95 | 444-542 | None |
| A0A7Z0CTL4 | 104-196 | None |
| A0A7T3Z4G8 | 254-363 | None |
| A0A6I7YP17 | 106-208 | None |
| A0A097IJP0 | 1-91 | None |
| A0A6N4V772 | 5-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.