DPCstruct | MC12477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 37.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B1QCT7 | 2-73 | AGHGYVKHDPAIERWNSMREGVYKHFRFTSRASWISISAVLLIPGSLIWISAQTDMKYDWTGKRKDESLYRS |
| L7I5L1 | 1-67 | MSLDPAIVKLGHMNTNRYKYFRWTPRTVKISLMYVVVVPSILGYFAYTTDGKWDFRAKRKGDDIREF |
| A0A4P9X6E6 | 1-79 | None |
| A0A316UFC4 | 1-77 | None |
| A0A420Y2X0 | 41-113 | None |
| X0AI80 | 1-55 | None |
| M5GGN0 | 116-189 | None |
| A0A077WSG1 | 1-63 | None |
| A0A5J5F5V8 | 37-115 | None |
| A0A1B7YQD3 | 68-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.