DPCstruct | MC12474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 139 ± 15 aa |
| Standard deviation of domain lengths | 14.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0598 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7BXH0 | 66-198 | KKDAADKAVKELFINDTPASDAIKDTTKQQTIDNAQKAIDLLADGPAKTAMQKDLDRAQELLNARQAAADAELKQQGAATYAVEQLF… |
| A0A4R6ZGG6 | 8-132 | GGFEKGLQEFGQKVYNLYDNTMFVTIAKGVTQADVDVAEEAALSVVGSGEKFRRMNLLNDAHQQFDANIDLQIKQQNDVARKAVNEL… |
| W7BA65 | 243-375 | None |
| A0A223EF47 | 9-134 | None |
| A0A223EFA5 | 522-647 | None |
| A0A842GHC6 | 6-145 | None |
| W7BMT8 | 58-217 | None |
| W7CAC7 | 454-572 | None |
| W7CFG3 | 271-418 | None |
| A0A7X1CEQ9 | 405-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.