DPCstruct | MC12473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 154 ± 13 aa |
| Standard deviation of domain lengths | 13.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7HMY6 | 1-174 | MGITSRMIPTEDASARKREIEEKLKQEQETLSFIRENLEKSDQLTKGMVSILSSFESRLMQLENSIIPVHKQTENLQRLQDNVDKTL… |
| A0A0R0GJA6 | 5-147 | RQRAVFVKESLHKSQTITDNMVSILGSFDHRLSALETAMRPTQIKTHSIRSAHDNIDKTLKAAEGILSQFDQTRMAEAKILRGPHED… |
| A0A818G6N1 | 7-152 | None |
| T1H6H2 | 1-166 | None |
| A0A816X1G8 | 1-166 | None |
| A0A498LLZ7 | 1-167 | None |
| A0A6N2NJN7 | 3-159 | None |
| A0A183W9I7 | 2-154 | None |
| A0A7S2TZ44 | 2-158 | None |
| A0A430QQJ8 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.