DPCstruct | MC12472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 118 ± 18 aa |
| Standard deviation of domain lengths | 18.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 50.60 |
| Pfam Score | 71.58 |
| Assigned Pfam label(s) | PF16543- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6QZJ8 | 1-102 | MDKWDQEKLEQVVKSKQGNPKTTTDIVCKYFLEAIENQKYGWFWECPNGGKKCMYRHALPPGFVLKTKAQKKAEEEGEDQITIEEFL… |
| A0A0S7HE53 | 11-125 | YVDERDEDLEKDTMENWDEKKLEEVVNKKHGEAEKKKAKTQIVCKYFLEAIENNKYGWFWVCPAGGDNCMYRHALPPGFVLKKDKKK… |
| A0A2I0HL54 | 117-237 | None |
| A0A3P7J2G7 | 30-195 | None |
| G0QLW9 | 125-246 | None |
| A0A453FVK3 | 21-117 | None |
| S6B750 | 117-231 | None |
| Q38M61 | 1-92 | None |
| A0A1A9A205 | 181-331 | None |
| A0A061FUK3 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.