DPCstruct | MC12471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 8.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0YEI8 | 218-324 | YRAFLASAKFVNAGSAPHLAFMAACAVDLWGVDLQTSYQHAFTAIRQLAVLLRSALALKTADAFRAVYCWQTVNCAELWARVVGAHF… |
| A0A0S7HDM2 | 1-109 | MYISYVQNCKFTSPNALPMINFMQRTLTEMYALDTHATYQQAFIYIRQLAIHLRNAMTMKKKETYQAVYNWQFIHCLYLWCRVLSIL… |
| A0A4W3GI65 | 214-328 | None |
| A0A3P6QU87 | 1-131 | None |
| A0A7S2S7C6 | 416-547 | None |
| A0A7T8KD38 | 262-382 | None |
| A0A0R3Q8U2 | 2-109 | None |
| A0A0B2UJ37 | 155-281 | None |
| A0A7R9ABJ5 | 488-601 | None |
| A0A815LB85 | 3-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.