DPCstruct | MC1247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 390 ± 46 aa |
| Standard deviation of domain lengths | 46.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392MKS0 | 1-379 | MQHREPIGGAHTDPSWTSQQIKIAINEAMDELTKLNTQDLLKDRNLKFRKLGGFQEGIPIDPKKGFNMRKRDIPVPPKISDSELEVE… |
| A0A7J7NPX0 | 8-478 | FFYVNLLGCLCLCILSNLFSLSCYSPEACAAILWKTAKAAPKAAEKLKITAKELCKLQIADGIIPEPLGGAHADPSWTSQQIKLAIT… |
| A0A6P5SLV6 | 188-607 | None |
| A0A2N9HMX2 | 549-985 | None |
| A0A2I0ACF5 | 34-422 | None |
| A0A835SES2 | 3-324 | None |
| A0A843W7L3 | 18-428 | None |
| A0A2K3NZC2 | 298-728 | None |
| A0A6J5U1B2 | 1-334 | None |
| A0A5B6UYV4 | 23-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.