DPCstruct | MC12469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 104 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09743 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7H866 | 1-109 | MADWEEIRRLAADFQRAQFAETVQRLSERNCIEIITKLVQDRKLDVVHTLDGKEYITPAQISKEIRDELYVHGGRINIVDLQQVCSH… |
| A0A0C2FRM3 | 1-116 | MATWADIQRLVSDLQRVQLSQSAKKLSEANCVEVVTKLIQRSLIDVVFTRDGHSYITQKHLETEVRNECVALGGRAALTDIATTLNV… |
| A0A438G1H8 | 54-151 | None |
| E4XWJ2 | 440-551 | None |
| A0A1J4MF65 | 3-107 | None |
| A0A7R8XE64 | 202-299 | None |
| A0A822DNR4 | 1-95 | None |
| A0A426Y468 | 70-169 | None |
| R1D057 | 2-113 | None |
| A0A212FJK4 | 4-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.