DPCstruct | MC12468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 222 ± 27 aa |
| Standard deviation of domain lengths | 27.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09726 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7LQZ5 | 2-174 | MWTLVLLADFVLEFRLEYLWPCWLFFGSVYTTFHYHGLVICVVFVCAAFTLDIFCLIFVPLHWLFFVASTYVLFNYIWHTEKGICIS… |
| A0A0S7H488 | 1-220 | MKRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFMRSVYDSFRYQGLAFSVFFVCVAFTS… |
| A7S5C7 | 1-232 | None |
| A0A6P6XSY4 | 1-217 | None |
| A0A6S7FM80 | 1-226 | None |
| T1EGL4 | 1-218 | None |
| A0A654GVE6 | 1-211 | None |
| A0A2H1CJE5 | 1-240 | None |
| A0A0K0CZ82 | 6-218 | None |
| A0A7E4ZVW2 | 1-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.