DPCstruct | MC12467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 178 ± 33 aa |
| Standard deviation of domain lengths | 33.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JSM3 | 5-139 | LQSHTQYWKSFDLLSLQQELDVTANDLATRQDESDSSRKRLVEQSREFKKVTAEEVRKQVAPLLKSFQVEIDSLSKRSKAAEAAFLN… |
| A0A0S7H0E5 | 1-146 | MAANAGSMFQYWKRFDLQQLQKELDATATQLANRQDESEQSRKKLIDLSREFKKTTPEDLRKQVAPLLKSFQGEIDALSKRSKEAEA… |
| A0A2J7ZVA1 | 10-151 | None |
| A0A2H1CDV5 | 1-186 | None |
| A0A1I7UHR1 | 2-237 | None |
| C3YDE8 | 2-236 | None |
| Q8IA98 | 2-172 | None |
| A0A480ZMD8 | 1-180 | None |
| A0A0L0DP75 | 7-223 | None |
| A0A835QPK5 | 19-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.