DPCstruct | MC12466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00095 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7GXP0 | 1-152 | MLPERACDVPGCRSDSECERHKRCCYNGCIYACLESVQPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGDEPLHCPT… |
| A0A6P5A9U5 | 139-275 | EPVEAGGDEYRCPPPLTVNRLRRRVCQQTKCVSDSECGAERRCCFNGCVFTCLDAVPPPAVLDWLEQPSPQRSAGYAWLVAEPEEVM… |
| A0A7E6F708 | 36-190 | None |
| A0A4W4G325 | 1-159 | None |
| A0A210QD97 | 6-174 | None |
| C3YMZ2 | 122-289 | None |
| A0A7N4V7X2 | 61-198 | None |
| A0A484D1K3 | 57-188 | None |
| A0A3Q0GGX7 | 77-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.