DPCstruct | MC12463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 92 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.00 |
| Pfam Score | 94.59 |
| Assigned Pfam label(s) | CL0465- PF02207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3T8M4 | 45-113 | TCSFTWTGPKHIRQDIFECRTCGLMDSLCCCSECARVCHKGHDCRLKRTSPTAYCDCWEKCRCRSLISG |
| A0A0S7GWQ1 | 20-107 | GQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIE |
| A2DHM2 | 172-247 | None |
| A0A0N0RSA2 | 1-104 | None |
| A0A2A2KLM3 | 378-479 | None |
| A0A109FKP9 | 18-97 | None |
| A0A835CN67 | 1-84 | None |
| A0A2B4S3T3 | 570-671 | None |
| A0A0B1PDR2 | 520-613 | None |
| A0A2H2HVW8 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.