DPCstruct | MC12462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 148 ± 16 aa |
| Standard deviation of domain lengths | 16.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CIB8 | 43-186 | AKWKDSLLPTEILERICKARGKSAPVYNLLENVVTVDGKEFRSKTEVKNETGNTIKSVEPLALQVLNNYQMIEPNIQFVKEHVETRD… |
| A0A0S7GTK1 | 1-155 | MKPSQILAKLCKEGKIDGPHYGPGGKVKVANRIFTGPTEIEDENGLKKQTEEHLALSVLNHWEEIPRVGCKLVPEHVETRPLLNPDK… |
| A0A4C1TK48 | 46-223 | None |
| A0A6P9AXB8 | 58-232 | None |
| A0A7J7IXB1 | 67-206 | None |
| A0A815TFE2 | 112-255 | None |
| A0A183KCQ9 | 67-215 | None |
| A0A7D9LM72 | 23-179 | None |
| A0A818GLJ3 | 836-956 | None |
| A0A4W3GT08 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.