DPCstruct | MC12461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 116 ± 22 aa |
| Standard deviation of domain lengths | 22.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 92.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7LY21 | 435-596 | FTCNRQPHFPEQPDDVLVLWVYALFMDKEGNYIKKTMPECTGDEILAELCYHLGIEDQLENVQKNTIVRTAFMPYITSMFMPRAKGD… |
| E8JPK5 | 2-117 | GVPENEIAEIANVVSTIPCHMPYITTYFIPRGLNDRPLVVPKHSKNLAFIGNYAETPRDTVFTTEYSVRTAMEAVYTLLDVDRGVPE… |
| A0A068DBR0 | 111-229 | None |
| A0A7U9MA01 | 94-224 | None |
| A0A7W3UXL5 | 271-426 | None |
| A0A831RY80 | 33-142 | None |
| A0A5F0E1S8 | 15-121 | None |
| A0A357NKT3 | 1-88 | None |
| A0A4V0BTE4 | 18-136 | None |
| A0A4R7DZ78 | 153-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.