DPCstruct | MC12460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 15 aa |
| Standard deviation of domain lengths | 14.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7JCN2 | 879-971 | VFIHADDAGRVTARSVESVALDHYMSTYNLSKGMHRESSVFTTMFGLLFWDLIYKEGLPDTFISEYQHQPLDFQTDLFYETRKEDID… |
| A0A819YJY5 | 3-92 | KVTYTIQDPIDGSIQFCTVEQLAINHYRTNEDYTYGIHSEEAIIQTLIGLLFLDLIYTLPAPNLLIDIFQTEPLDFHTDTFYKSRQN… |
| A0A1X7SMV8 | 2-109 | None |
| R1H0G0 | 343-471 | None |
| A0A815IR03 | 101-198 | None |
| A0A0R3UE86 | 239-334 | None |
| A0A812S7M1 | 38-143 | None |
| D8M1J8 | 26-151 | None |
| A0A2G9V4G7 | 66-160 | None |
| A0A0L0S8L3 | 156-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.