DPCstruct | MC1246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 17.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446YC02 | 172-301 | NKSDVSDSELIQFSTARFRHLLLFSNERDWCSLTKTLLEILSKRSMVSEELSHETLEMLSEIHLLNRAVKRKSSHMVHLLVHFVVIC… |
| A0A7J7NN52 | 90-238 | YMFWFAYYPVCKGNNESLDTGPYRSSLLHYSLRWLKFILTFSVERDSSSLAKTLLDLFLEINSDEGSLSTESMGTLLEIHLLNKTVK… |
| A0A426X4Q0 | 1-131 | None |
| A0A453RKE1 | 470-622 | None |
| A0A453RB63 | 246-378 | None |
| A0A7J8U4L4 | 281-407 | None |
| A0A287W7Z2 | 62-180 | None |
| A0A287W7T5 | 26-181 | None |
| A0A426ZJQ6 | 550-694 | None |
| A0A2I0A7N8 | 445-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.