DPCstruct | MC12459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 220 ± 27 aa |
| Standard deviation of domain lengths | 27.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.83 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0509- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N6A2D8 | 293-543 | PGATCQRRMTWQWRGEIMPASRSEFHRIQQQLESEKFPPFFPNGPPRAFHTLNREEQAKHEKKRLADYCKKAYKKIHVTRLEERVTT… |
| A0A819VWN6 | 1-193 | NNTLSFHELPQETQLSIERKRLAGYCHKAYKKVNHTREETRETTVCQCENSFYVDTVRAFRDRPNASKKDDLNEVKRCNNLVVIHDS… |
| A0A151NJJ3 | 656-865 | None |
| A0A287F4W6 | 28-277 | None |
| A0A0M0K3P2 | 462-676 | None |
| A0A820SP40 | 109-270 | None |
| A0A5K4EYZ8 | 458-677 | None |
| A0A7J8PZ16 | 70-312 | None |
| A0A251TTH4 | 188-380 | None |
| Q9VCN1 | 656-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.