DPCstruct | MC12458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 162 ± 27 aa |
| Standard deviation of domain lengths | 27.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819VVI7 | 29-173 | VTGISISFPPREPPENPVIYLYIISKNTIVTSLLASKIYQTATESEKNSEKKLVYQSRQKMFDEHATAIMNRCFHTNEDFAIQVLTS… |
| A0A1L8FHE0 | 3-122 | EAVSSALAAMKLLKDLSRMQSEAEESLAMRDLAARFEQLAIGVFNECYRNSENRAFKLLVRRSSIWGGATCLQLAYEADARNFFAQD… |
| A0A0K0E7T5 | 487-707 | None |
| A0A0R3UE59 | 653-819 | None |
| A0A821TG42 | 36-189 | None |
| A0A1S3PWR0 | 158-325 | None |
| A0A7R9L152 | 91-320 | None |
| A0A820CI32 | 276-425 | None |
| A0A812JXJ5 | 479-661 | None |
| A0A815JJ53 | 4-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.