DPCstruct | MC12456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8NX86 | 1-94 | MVEWRISIYGRSIQEWDKLAAWVVDNKLFSPNVRWLVQIPRLYDVYKSSGMMENFEQVITNVFQPLFEVTKDPNSHPKLHLFLQRVV… |
| A0A819UAK8 | 429-513 | AEFHMSIQGRSMDEWDKLAKWFLKNEIHSTNVSYMIQVPRIFTTHRASSKLKNIEELLTNLFQPLFDATIHPESHPDLFRFMRYF |
| A0A6L5CH67 | 256-346 | None |
| A4HVM6 | 1268-1357 | None |
| A4HS23 | 1235-1326 | None |
| H8ZDC3 | 250-350 | None |
| A0A445B6A3 | 94-187 | None |
| A0A668AM50 | 323-414 | None |
| A0A086JZI8 | 219-313 | None |
| J9BIV8 | 62-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.