DPCstruct | MC12455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 11.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 61.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814FWR3 | 47-136 | NSNTQKLQIADESTLSRYVAARLDLPVSQRLLDKPFKLSIIKRCWEDQLRLKQDDFETDSDLLIACIILQKQIDCINGKKENIIVPS… |
| A0A815ACM0 | 17-118 | MTKLIVDRLNTPIAQRLFTVFSKSVVKRCFEDQLRLKLEDFVTNNDLFIACVILQKQIDVINGNSENVVIPKQKLNDINQKQMVVVK… |
| A0A815VZ12 | 105-203 | None |
| A0A814DQ70 | 249-343 | None |
| A0A815Y457 | 31-152 | None |
| A0A815AUV0 | 891-1005 | None |
| A0A815LUD5 | 416-521 | None |
| A0A813N1P6 | 230-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.