DPCstruct | MC12454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 308 ± 39 aa |
| Standard deviation of domain lengths | 38.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821TNW5 | 250-565 | MKEFGAIYTSGITVFRQTEANGYAFMKNPLYNVCAIAMAAYRDPELTKEKMLEKKFAINTHKKIENIFAIAHHHKHDCLVLSAFGCG… |
| A0A819TZS3 | 4-314 | MDEYGAIYTSGLTVFRQPENTGYEYMNKPLYGVCSLAMAAYRDPMLNGTMLAPKYAVGMRKKIENIFAIAYHHKHDCLVLSALGCGA… |
| A0A817V358 | 409-713 | None |
| A0A815GYG5 | 66-378 | None |
| A0A815I6N9 | 203-551 | None |
| A0A819ZYQ8 | 208-519 | None |
| A0A814KWY0 | 1-305 | None |
| A0A820UE01 | 555-917 | None |
| A0A814LUB1 | 1-369 | None |
| A0A817XBG6 | 66-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.