DPCstruct | MC12453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 133 ± 20 aa |
| Standard deviation of domain lengths | 20.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.72 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF00177- CL0020- CL0613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1IY42 | 6-133 | MQLLRSAMKKDPKSYLDELFLQMRHFEANVNIFKSKPSKPMHDLQETAALLAHVTPCYPRELASFPSQLVGLLEQFHLVMDPGLRKE… |
| A0A819SSJ3 | 2-111 | PGNDRLTRSLPHLQNLIKRDPDAYREDFKLQYLHFESQFMELTAKPDIWNKSLAENISFVSQVAHCYPEESKGLSQMFMDVLRLYST… |
| A0A194QBG7 | 2-139 | None |
| A0A5J9SPK2 | 10-132 | None |
| A0A812I3Y3 | 312-449 | None |
| A0A835R6H6 | 315-451 | None |
| A0A2B4S8Q8 | 1-122 | None |
| A0A6I9JR07 | 2-111 | None |
| M1A0M1 | 4-200 | None |
| A0A5A7T0H3 | 3-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.