DPCstruct | MC12452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 50 ± 6 aa |
| Standard deviation of domain lengths | 6.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 57.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00690 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671QWC2 | 1-41 | MENAHTKTVEEVYIHFAVNESTGLGLEQVKRQREKWGPNGE |
| A0A3P9IPV3 | 1-57 | MENAHTKSATEVLDHFGVNENTGLTQEQVKVNLEKYGLNGEYFPSCFGWNSQTNLLK |
| A0A7R9HLL4 | 1-60 | None |
| A0A3Q2PVM6 | 1-44 | None |
| A0A4Z2HII5 | 177-223 | None |
| A0A3Q1I2I9 | 1-46 | None |
| A0A673BMY7 | 1-50 | None |
| A0A402EEF5 | 1-58 | None |
| A0A2I3FQ36 | 1-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.